DPCstruct | MC37885
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 155 ± 22 aa |
| Standard deviation of domain lengths | 21.94 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 26.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04931 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A433Q7C1 | 3-177 | NSTTLPLYWDLASVDPQVRENAANSLITSLANFQNAHKMTVKDKWDDLLEWDDSEKRLDALSAPDVSYALRRLIRGLPSSRQGARQG… |
| A0A5J4WI56 | 14-182 | SLLDLFWLLDSNDKSAALQGISKILSRVSQKQKEKESELESDIDESLQKLSKQLRRDEQGKHCIELDYCIMRLIRGLGTPRSEVRHT… |
| A0A6I9Q0R3 | 14-140 | None |
| A0A7J5ZYK0 | 1-120 | None |
| A0A437CNA5 | 1-148 | None |
| R1C276 | 1-157 | None |
| A0A0N4VX95 | 4-120 | None |
| A0A7N0TMN2 | 98-268 | None |
| K3WSV6 | 71-224 | None |
| A0A5P1EV51 | 88-267 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.