DPCstruct | MC37884
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 81 ± 9 aa |
| Standard deviation of domain lengths | 9.42 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 40.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J4U5D8 | 107-179 | DKTIPYSMEVPIVGFNSSRFDISLIIQQMQCKDWTINNYIGSPTIAKQVIVHHKKLNLKVKFVDMLTYLQPME |
| A0A5J4WHV6 | 1-78 | MKYDDENIPFDKSVKVLGWNSSRFGIALLWDALDCELWTMGVSIGDLNITKSITVIHKKSHMKLQFICAENLFGPMTL |
| A0A5J4VQ93 | 477-556 | None |
| A0A5J4VT95 | 1-77 | None |
| A0A5J4VZ12 | 256-331 | None |
| A0A5J4VQ03 | 1-88 | None |
| A0A5J4UGF3 | 281-348 | None |
| A0A5J4UH54 | 331-405 | None |
| A0A5J4UI02 | 90-178 | None |
| A0A5J4UJP8 | 153-221 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.