DPCstruct | MC37874
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 91 ± 13 aa |
| Standard deviation of domain lengths | 12.96 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 40.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A175W4Z7 | 96-178 | GRFAAKEAVIKAHPHIPGLSFRSIVIMSMQGAARTLDPRAESCPPVALLKTRELLGAGARDQTALLSISHDKDYATAVCIGFD |
| E3QIR4 | 29-132 | TRTCNNETDKEARFAAKEATFKAHPFRRLSFHDITIVRRALVEGKANPNGSGPPVAIIRGEREGEPGQTAMVSISHDGDYATAVCLG… |
| G0S3U3 | 114-222 | None |
| N4VE97 | 3-90 | None |
| A0A194V8V9 | 1-76 | None |
| A0A842Z684 | 27-99 | None |
| A0A2J6PR23 | 71-153 | None |
| A0A4Z1KMA6 | 151-243 | None |
| G2QL44 | 7-103 | None |
| B8MDM1 | 49-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.