DPCstruct | MC3787
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 172 ± 10 aa |
| Standard deviation of domain lengths | 10.11 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 86.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 19.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10688 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H4B2M6 | 13-179 | MELAGQLVSLTALVLCLIAFASKQDQRLMVWLLAANVAFALQFALFQSWTASVLTLIVILRIILARRYPGNLWLLGVILALNMAGAW… |
| A0A401J2N6 | 1-197 | MPYLIDDAIYTASAISILLGMIGLACVMTWPFLRCLRRVIVVQSVGAVAFTLQFSVLGASTAAVACGISLAQLLIALTVRDRGVRSA… |
| A0A6N4RCM1 | 1-175 | None |
| A0A328EI96 | 19-180 | None |
| A0A2A5GTP7 | 27-195 | None |
| A0A2X3CVQ1 | 1-187 | None |
| A0A316QEY3 | 12-188 | None |
| A0A7T3E873 | 1-168 | None |
| A0A3M1JFP8 | 68-227 | None |
| A0A2E6YFR1 | 24-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.