DPCstruct | MC37866
Metacluster Properties and Pfam Annotations
| Number of structural domains | 126 |
|---|---|
| Mean domain length (aa) | 202 ± 30 aa |
| Standard deviation of domain lengths | 29.83 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 14.87 |
| Pfam Score | 42.86 |
| Assigned Pfam label(s) | PF18941- PF07285 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A356TME2 | 98-301 | CEASLAGYVRQVTRTLRDRAAQASAPADAGQLLPVLRPTGYAQMVHERTGVAGVPFGAELVALVVLDSPTTAQPVDTDLLARLGLSS… |
| A0A512M214 | 18-194 | EKPKLETLLMLPEPKEMRTERSVVPEGAQATVLTPAREIADVPGIEVYPKEDFAKLGLSPETFAERSKKTAEKLLTEIKPDVIKGAD… |
| A0A1H9FCD8 | 360-560 | None |
| A0A2T0KID5 | 62-247 | None |
| A0A810KTF2 | 128-354 | None |
| A0A3S0ZRK1 | 342-544 | None |
| A0A2S8H7U9 | 65-276 | None |
| A0A847F7P4 | 195-372 | None |
| R9MEK0 | 9-172 | None |
| A0A4Q7YMW3 | 337-539 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.