DPCstruct | MC3786
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 338 ± 30 aa |
| Standard deviation of domain lengths | 30.08 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 24.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A3MR57 | 1-377 | MTITRPEADAIIKRSTGGYATAQSGPAQLAFLIGSPTDDSLKGGACSIFDFRMTLDVGEADRLRAVRLASYFADDWVQIRVDGTLVA… |
| A0A401J000 | 1-313 | MTLRVKDSDRLRQVLLTRFGADDWAQIRVDGELLGSGPQSWTGTGLPPGKCEKKGAFYLNPALDLTSRMTQGDHDIWLRVAVAEGGE… |
| M3ULP5 | 102-414 | None |
| A0A1F9LWI4 | 2-279 | None |
| A0A7X6DU79 | 268-595 | None |
| V5FM62 | 204-565 | None |
| A0A143B348 | 306-663 | None |
| A0A0B8PX42 | 102-452 | None |
| A0A0F9NGI2 | 226-586 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.