DPCstruct | MC3785
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 123 ± 19 aa |
| Standard deviation of domain lengths | 19.15 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 87.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 28.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05045 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A249N167 | 13-127 | AFFIQNLNRSRYGIIYPQSFHNLPYMAATWLANGGLARKWAPQFGVNALPDGYFDFPIGSMFWAKTDAIRPLLDAGLQWSDFPPEQG… |
| A0A3T1DM22 | 2-111 | VGPAGHWLDYVHYWGDLQSPVRTQALLEHLGIRISLDELGFFAGSMFWCRPEAIIPLLTITDSDFEPEEGQTDGTLAHALERIFAAA… |
| A0A5C7V9V9 | 310-428 | None |
| A0A1V5VIR8 | 47-173 | None |
| A0A530BPX1 | 3-139 | None |
| F9Y4A8 | 568-696 | None |
| A0A4Q8TT18 | 7-121 | None |
| A0A3S0EVF5 | 165-279 | None |
| A0A317MXU6 | 1176-1272 | None |
| A0A354SNG6 | 5-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.