DPCstruct | MC37849
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 100 ± 11 aa |
| Standard deviation of domain lengths | 10.66 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 71.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 35.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0665 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6U2AD63 | 1-97 | GGEVPTTGKRMLEQDFTNDSPMTYEEKRELCANMNKLPGKKLGSVVQIIHDRNPKILQQNGEDPDEIEIDIDRIDAATLRYLEVFVK… |
| Q0DES3 | 8-87 | LEELRQMVVQKCRKMTTYEKRKLGAGLCHLSPEELTKALEMVAQDNPSFEAKGDELELDMDAQSETTLWRLKFFVREALE |
| A0A0V0J5U4 | 223-324 | None |
| A0A4Z2EE24 | 1-85 | None |
| A0A803QHR8 | 166-262 | None |
| A0A2K1IXP6 | 20-137 | None |
| A0A821RA41 | 2-103 | None |
| A0A4Z2E0G3 | 1-92 | None |
| A0A834IJE5 | 36-130 | None |
| A0A7S2SMM9 | 8-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.