DPCstruct | MC37846
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 166 ± 16 aa |
| Standard deviation of domain lengths | 16.07 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 73.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 16.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A662FBK3 | 1-149 | MKRGGKVKFKIKGKGHTAKVDKVFSDHVVLIIESDPISVELYVNETKRVDVDADGTDDLEITLHKIESVKAYMTFTLLGVEAAEKGE… |
| A0A1J4W714 | 640-799 | PGRSAPVFNIKITSLEEGYTNTFYENWGITFFVSEEEHRLIIDEILNESVVVSISSEPITEEVFLGKPEKFDLNNDGYYDLRIEVNE… |
| A0A0B3AV48 | 14-174 | None |
| A0A0F9KQK2 | 43-227 | None |
| A0A6A2FCF9 | 9-172 | None |
| A0A3M0Y476 | 969-1159 | None |
| A0A7J2KLZ7 | 669-839 | None |
| A0A2D6RK85 | 42-197 | None |
| A0A5C7J426 | 100-277 | None |
| A0A1F6ZFH4 | 782-957 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.