DPCstruct | MC37844
Metacluster Properties and Pfam Annotations
| Number of structural domains | 72 |
|---|---|
| Mean domain length (aa) | 115 ± 13 aa |
| Standard deviation of domain lengths | 12.75 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 30.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03891 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| O28332 | 4-110 | VLLCFLTLILLLPAASALRNPSAVYCEAMGYNYVIFSSPYGDVGKCVLPNGEAVNAWDFYRGVVALEYSYCAKQGYEAKHVEREDCK… |
| A0A497EJH9 | 34-154 | QREVEEITAPAIEEEFPEKETGIPNPASVYCEDLGYNYVIRTNPKTKGQYGICIFPDGNECEEWEFYRGKCGQKFTFCEQQGFRIEN… |
| A0A2G9LUI6 | 4-133 | None |
| A0A846NH13 | 4-122 | None |
| A0A0B8WHS2 | 14-133 | None |
| A0A7D5XJ61 | 59-163 | None |
| A0A151E8Y2 | 152-262 | None |
| A0A3M1JIT6 | 5-120 | None |
| A0A2H0YBN3 | 54-162 | None |
| A0A1J4UKH0 | 1-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.