DPCstruct | MC37840
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 92 ± 7 aa |
| Standard deviation of domain lengths | 6.64 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 44.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07287 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A535QCP6 | 1-86 | MAHIGYPIAEVWESGEAVISKAPGTGGRVNFDTLREQLLYEVHDPRHYMTPDVDVNMTTLRMEEIGPDQVRVTGATGRPAPDTLKI |
| A0A257V301 | 70-163 | TGGNFTRWWEVPELWDVGYPVLECAPDGSFVVTKHAGTGGLVSTSTVAEQLVYEMGDPHAYITPDCVADFGSARLAADGDNRVRVSG… |
| A0A163BZ50 | 245-334 | None |
| A0A5N6XES4 | 124-214 | None |
| A0A1B8EH99 | 227-316 | None |
| A0A287X0U7 | 111-187 | None |
| A0A084RXG7 | 220-314 | None |
| I1BPA7 | 250-343 | None |
| A0A7W1ACW3 | 361-456 | None |
| A0A2V1BDF6 | 89-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.