DPCstruct | MC3784
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 161 ± 13 aa |
| Standard deviation of domain lengths | 12.80 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D5GMJ7 | 1-148 | MWIGVKHEMLMFEAAVTAADAVKDILRQAGFLNIEVAFRESEVMCSVGGPKLLSFDPLVDPIPEFCKAFTPTLGLSIALLRTPHYEG… |
| A0A7C8RI11 | 107-266 | IIWVGIEPVDNLEHHLGEEVAIQCQAIIDQHKINDCYVELRASKRQDSAGVRFLDLTDPNEDLAYEYKGPFRSTLGFPICSKKTPHK… |
| A0A1J7I692 | 109-266 | None |
| A0A2T4C5F7 | 2-154 | None |
| A0A4Q2DRB1 | 96-273 | None |
| A0A4R0S460 | 422-589 | None |
| A0A4S4MR04 | 103-284 | None |
| A0A3N4JQL6 | 109-252 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.