DPCstruct | MC37831
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 220 ± 33 aa |
| Standard deviation of domain lengths | 33.29 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 19.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1T3C9T2 | 130-387 | RKYIAATMDEITATHDPAYEFRESDQYYLSNVWGRQEYWRSRVMKGKAPAGPPGRIVPVKNSPFQKTEYHVAIEYESALFQTKAGYE… |
| A0A5N6FMM8 | 234-463 | TGLNPRLETGHRYEYGIGVDYESRLFFNMWNSKKDVEWLQYNNVSKTSSVQMQHGVPRERRLLLPDDLNPENLSSPFTQPKFGKDEP… |
| F9XPH3 | 323-523 | None |
| A0A4Q4W3I0 | 176-414 | None |
| A0A0G4KES6 | 654-809 | None |
| C9SA48 | 356-592 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.