DPCstruct | MC37830
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 100 ± 12 aa |
| Standard deviation of domain lengths | 11.53 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 36.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0559 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q4ZAQ2 | 5-95 | LIGGRSVAASQYCDGETGVCYSETKVGVAPITWRVAIPAVEAGPFDILLQVVAPRTVGWAGIAWGGGMLYNPLSVGWPNGDTSVPAS… |
| A0A364MXX9 | 202-286 | EAQSTIVYDEETKISYSSYTEPETGMTFGVALPTNVTDPYDAIIRVTAPIANQWVGFSWGGNMVWNPLSVAWPNGQSGTISARFA |
| A0A4Q4Z0E3 | 13-112 | None |
| A0A6A5UUS6 | 1-134 | None |
| A0A420Y0J3 | 17-106 | None |
| Q2GTS9 | 20-120 | None |
| A0A4V1XEX9 | 933-1017 | None |
| E4ZUU3 | 158-270 | None |
| H0EKM7 | 1-84 | None |
| A0A2G8RRV7 | 1-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.