DPCstruct | MC3783
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 193 ± 25 aa |
| Standard deviation of domain lengths | 24.72 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 74.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 20.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D5GES9 | 1-196 | MSYAPKRKTEGGSDRPTKLAARPRQPAFHNLREKYPTVEKLEEHLKSLSRPAVEALILSGAFPEAASDLRHCVYCHKTFHRLANRGG… |
| A0A0C3D0P4 | 3-184 | TTFEILRQAAIAQANTISPSFHQDIVALLKDKYLNRAELDLIRDYLRAVTWISDLNAYIAMKDKETNFQHCVRCHCLFSKQYGDGPN… |
| A0A4Q2D3P2 | 59-268 | None |
| A0A1W5BHY1 | 227-416 | None |
| A0A6F9DII5 | 336-509 | None |
| A0A0C3CIM3 | 4-167 | None |
| A0A5C3MF20 | 112-326 | None |
| A0A5C2SSD3 | 70-262 | None |
| A0A3N4JF67 | 18-206 | None |
| S7QI41 | 1-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.