DPCstruct | MC37826
Metacluster Properties and Pfam Annotations
| Number of structural domains | 297 |
|---|---|
| Mean domain length (aa) | 192 ± 55 aa |
| Standard deviation of domain lengths | 55.03 |
| Length coefficient of variation | 0.29 |
| Mean AlphaFold2 pLDDT confidence score | 90.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 19.63 |
| Pfam Score | 49.58 |
| Assigned Pfam label(s) | PF03460- CL0344- PF01077- PF04551 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q4WLK0 | 4-171 | GEVTADGLIAVGQVAKKYGLYTKITGGQRVDLFGARLEQLPLIWEELIAAGFESGHAYGKSLRTVKSCVGSTWCRYGVGDSVGFAVA… |
| K3Z3K0 | 714-922 | LGWQEQGDGKLFYGVHVDNGRVGGQAKKTLREIIEKYNLDVSITPNQNLILCGIDQAWREPITTALAQAGLLEPKDVDPLNLTAMAC… |
| A0A2R7SG08 | 197-375 | None |
| A0A7M3LUK0 | 198-446 | None |
| A0A7V9V9C0 | 53-284 | None |
| A0A0L6VZD2 | 32-251 | None |
| A0A3M2C4V6 | 288-531 | None |
| A0A2V7Y6P9 | 177-467 | None |
| A0A7S2JHJ5 | 126-400 | None |
| A0A4Q6G721 | 10-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.