DPCstruct | MC37825
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 133 ± 17 aa |
| Standard deviation of domain lengths | 16.97 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 92.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 26.62 |
| Pfam Score | 89.09 |
| Assigned Pfam label(s) | PF07364- PF07171 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q4WD55 | 4-140 | TGEHAGRLLFDKLAGRANPVLAWRRLPMVTHTLRSRTDEGAMHRAVALAKQAEQDGMLAVSILAGFGLADIAAPCLSVVVVGNGEKH… |
| A0A7W0Z3X7 | 164-282 | PHVDMPETGARALDLLVSVARGEVRPAMASARLPLIVPNQSMVTTWQSPLKVAIDRAREIEREPGVLAATVIGGFPFADVPFAGVAT… |
| A0A4P5SSF6 | 175-305 | None |
| A0A3M1D9S7 | 327-442 | None |
| A0A4U9CRY5 | 9-127 | None |
| R8BHQ3 | 505-631 | None |
| N9QFN0 | 39-171 | None |
| A0A2W7PA27 | 80-219 | None |
| A0A7J4FL51 | 107-211 | None |
| A0A4R9EU57 | 498-614 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.