DPCstruct | MC3782
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 72 ± 8 aa |
| Standard deviation of domain lengths | 7.85 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 55.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08122 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A098E231 | 4-66 | FQASTGQPRYDPWERNEAWRYQGPYTRWNRLKSGFPGLGIATVAFTAYCGYEYFFLEDEHHHG |
| D5GEH8 | 1-72 | MTPRPPFDPQILLKKPTRPDPWARAETWRYTGPFTRWNRFKGAFPGLGIATVAFATYCAYEALFLKKDEHHG |
| A0A2V1AT17 | 30-106 | None |
| A0A6A5QNM8 | 1-82 | None |
| E5AB17 | 48-126 | None |
| G3JQU1 | 46-113 | None |
| A0A4P9ZDY4 | 1-57 | None |
| A0A166YHS4 | 105-172 | None |
| A0A0K8L2R9 | 1-81 | None |
| A0A2U3EBL4 | 179-255 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.