DPCstruct | MC37816
Metacluster Properties and Pfam Annotations
| Number of structural domains | 81 |
|---|---|
| Mean domain length (aa) | 109 ± 13 aa |
| Standard deviation of domain lengths | 13.22 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 24.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0043 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A6TU01 | 7-117 | FTLLAVVVAGCSPSSQDDSNDKYQVVATRTMLADLVSVIGGEYVTVTGLMGPGIDPHLYNASAGDVNTIQSADLLVYNGLQLESKLG… |
| A0A7G8DUP1 | 2-93 | LTTFTVLADLARNVAGDRLTVRSIVKPGSEIHGYQPTPSDIERASDADLIVENGLGLELWARKFTASAGNIPTLTLSDGMEPLLIEE… |
| A0A380H7Q0 | 8-89 | None |
| A0A0H3I6U5 | 10-94 | None |
| A0A3B9Y6L2 | 13-130 | None |
| A0A3C1NZK5 | 135-243 | None |
| A0A2E3X1P9 | 9-110 | None |
| A0A7C2QJN0 | 2-100 | None |
| A0A1I2TXS3 | 57-146 | None |
| A0A7C4WHT3 | 11-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.