DPCstruct | MC3781
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 264 ± 19 aa |
| Standard deviation of domain lengths | 18.81 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 68.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.86 |
| Mean length-normalized TM-Score | 0.21 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.56 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | PF10453- CL0537 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S2MWK8 | 145-415 | LKTPPQSSYGQYAYPLDTCTGDTQPPNKKQRLGRSSRPDMSEADWLALNGGKLIGTNILPPQTDEEIAGWIAERKKRFPSKATQVER… |
| D5G5W6 | 1-230 | MDEETWLRLNGGKLLGTNLKPPETPEEIEEWIRERRRRFPTRERVAAKVKEEEEKKRKLAGASDASAETVRAQAPATSRQALATAQQ… |
| A0A2N6NGJ7 | 205-469 | None |
| A0A4T0VNR4 | 68-316 | None |
| A0A197JYV0 | 245-527 | None |
| A0A0M8MTQ1 | 26-278 | None |
| H0ERN7 | 85-372 | None |
| U4LSD9 | 1-232 | None |
| A0A1Y2DSK0 | 282-548 | None |
| M7T0F3 | 227-499 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.