DPCstruct | MC37805
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 255 ± 52 aa |
| Standard deviation of domain lengths | 52.07 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 89.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 25.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14224 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1T1J6 | 3-245 | FFAGNADDPFFLDDTGANRLVASSIKNPGHPDFSLLGERKGRDTYAGFNTLITALDIPVALLKGSGNIIGINAVTQRQQDQHIERGH… |
| A0A8B6M4Q7 | 6-236 | KEMVTTSEGLRIWAGQAGDPFWIEPEVLHAVGHALQDGTPVNLAGWDPNQARNLFAGHTVYSIVLEVPDAALLADAPGRRRIGVWAV… |
| A0A7X2PQN9 | 8-251 | None |
| A0A534ZAF0 | 216-509 | None |
| A0A7Y0JPE5 | 107-373 | None |
| A0A4R3UXR9 | 21-231 | None |
| A0A7W1P9N0 | 1-324 | None |
| A0A7C6ZUD0 | 163-528 | None |
| A0A110AVS6 | 57-300 | None |
| A0A7Y1VJE0 | 46-366 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.