DPCstruct | MC378
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 365 ± 39 aa |
| Standard deviation of domain lengths | 39.15 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 18.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H6ICC0 | 249-615 | YATLLSQPKIKTNIIWEGSGGIKNYPSWTASRKADLNNSILRLEKGEPQALSAPPALLSGGYISASDAWQIYIAHIAQSLWTEVHGA… |
| A0A497XCK1 | 28-377 | PPSVSCWLRAHPNVANAIKWQVMFQVSAYDIPETAKRAWPNWSSQERARLDTAFDEAWEWMQAQSGTFSASAEGLPYPPVNVRDTTN… |
| A0A2D6R7A5 | 2-291 | None |
| A0A1F9B9U6 | 122-472 | None |
| A0A7J4QC21 | 132-518 | None |
| A0A6B1AKM8 | 214-600 | None |
| A0A0Q4GLW5 | 27-359 | None |
| A0A534TZ06 | 175-511 | None |
| A0A7Y1Y4Y3 | 50-444 | None |
| A0A7T9HPM8 | 68-510 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.