DPCstruct | MC37795
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 147 ± 15 aa |
| Standard deviation of domain lengths | 15.09 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 24.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13148 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8A9AMS6 | 156-298 | RDRGLLGRILFSLPVDLVGHREIGPDQVSPEVVESYGDNLRSMVRALAEWTDPAVLTLTADAAELVLDLEREVEPKLRMGAEFGHVR… |
| A0A6D0TGS1 | 4-127 | SGHHARFLMCQPTSTQGTRIITGDNYSSQYQDLFEERINELIDESLAMSGERRCLHFSPQAARIWTDYYNDVESKLGGLGPLRHCRE… |
| A0A377C4Y8 | 2-147 | None |
| A0A1G9XTX6 | 17-157 | None |
| A0A366M931 | 2-136 | None |
| A0A179BHS3 | 146-328 | None |
| A0A1V3Q3C9 | 200-356 | None |
| A0A656YHS5 | 8-149 | None |
| A0A354HG33 | 33-207 | None |
| A0A3W5CVA1 | 24-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.