DPCstruct | MC37794
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 175 ± 46 aa |
| Standard deviation of domain lengths | 46.12 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 81.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 33.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0182 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6D0M8Z2 | 31-201 | AVKMLKSFGHSRAHYAIGLAGLICALPLFFEVAVVLLISVAFSMARHTGTNLVKLVIPLFAGVAAAAAFLLPGPAPMLLASQMHADF… |
| A0A2T4RN75 | 11-140 | LGKLLADGGGATRIADTLIQKFGQKHVQWAMLVAAFIVGIALFFEVGLVLLIPLVFTVAKRANVSVLKLGLPMVTALSVTHGFLPPH… |
| A0A378W1B7 | 2-143 | None |
| A0A6N6X9R6 | 5-142 | None |
| A0A380BW74 | 79-203 | None |
| A0A7G3DAL9 | 2-159 | None |
| A0A2S9RYY9 | 75-219 | None |
| A0A379W0P5 | 1-158 | None |
| A0A1Q7LRG3 | 60-262 | None |
| A0A4U9TRA6 | 1-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.