DPCstruct | MC37793
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 104 ± 17 aa |
| Standard deviation of domain lengths | 17.18 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 45.15 |
| Pfam Score | 93.37 |
| Assigned Pfam label(s) | CL0052- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6D0M6I8 | 4-117 | AGIVMSDGRFAACNLDRNGLRPARYVITKDKLITCASEVGIWDYQPDEVVEKGRVGPGELMVIDTRGGRILHSAETDHDLKSRHPYK… |
| X8BHX7 | 149-243 | DGPASMTFTDGTVVGAVLDRNGLRPSRIWVTDDGLVVMASEAGVLDLDPSKVVRRMRLQPGRMFLVDTAQGRIVDDEEIKAELAAQH… |
| W4QIA8 | 355-447 | None |
| A0A2R7RNQ8 | 238-325 | None |
| A0A397EI07 | 63-173 | None |
| A0A212DLH0 | 110-234 | None |
| A0A182TIG5 | 265-373 | None |
| A0A0Q9XCL6 | 412-531 | None |
| A0A5K4EM75 | 111-195 | None |
| A0A5E4PR16 | 293-389 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.