DPCstruct | MC3779
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 109 ± 12 aa |
| Standard deviation of domain lengths | 11.70 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 24.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7U9Q7W3 | 32-126 | IDLNQPDALTLEAVRQLLASASDNVHTQLRVSKTGIAYISSGVVGGAEIEGLLFRLETWAAGSGYVGKVAAADEVWVMQIFNALKQN… |
| A0A4Q3HFL5 | 1-114 | MVKYKLRLPSKEQLIKVLTLGNDSKDNELILTNRCAFVLRRPKNNSDDVVVRHKVFNAGENFVGKDAAKDLDYIESLYCSFLEKWIA… |
| A0A8B6M677 | 69-169 | None |
| A0A1Q8Q2A7 | 1-129 | None |
| A0A0P9Y972 | 24-140 | None |
| A0A396AL22 | 480-594 | None |
| R9KFP3 | 37-127 | None |
| A0A254T6U4 | 1-117 | None |
| U2BDM8 | 469-562 | None |
| A0A2N5I851 | 25-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.