DPCstruct | MC37789
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 131 ± 15 aa |
| Standard deviation of domain lengths | 15.26 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A496JW32 | 51-183 | FLLAKTVIEQESRFVDELVLRAMLHASPIDLTSSENADKAVAELSGLLDEKEVALERIEGHEGNRFIKITRKLHGNVMVSYIEPKFL… |
| A0A6D0LZ99 | 8-141 | ITRMERRYPKTLLKELVYQPTLTEADLSDEQTVTRRVNALVTDLNEKEQHGSMWKCDIQQNADKQFEPIIRVRTHGVDTDYPLEHEF… |
| A0A5R4S9U9 | 2-136 | None |
| A0A7X3QFG6 | 200-337 | None |
| A0A6M1HWA5 | 85-173 | None |
| A0A418H122 | 423-563 | None |
| A0A2G2PBU4 | 26-179 | None |
| A0A2E7C2K8 | 588-729 | None |
| A0A1A9X788 | 479-619 | None |
| A0A2E2QM47 | 288-422 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.