DPCstruct | MC37787
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 115 ± 20 aa |
| Standard deviation of domain lengths | 20.01 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 82.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 53.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S3LUS6 | 1-89 | MPPTTAEHYRNKIAVYLQWYRSRDFPDDIPDEQEKDLGYRDIPSWRRICKTLIKNDFWCKTLSFSPTRPQHYERYCQNIRQKRTQWG… |
| A0A376LJQ2 | 109-244 | MCARVSGVKSGGIYAGHDNHFYGHRKILKPEHLDWQEYALLLLNSMPEKTAEHYRNKIAIYLHWYQKKGIEVPQTQQGDIGAKDIPS… |
| A0A2D6XAC8 | 475-582 | None |
| A0A485CJQ8 | 160-296 | None |
| A0A377Z8R4 | 25-131 | None |
| A0A521HP28 | 63-193 | None |
| A0A2X3D364 | 1-137 | None |
| A0A376KYL3 | 39-174 | None |
| T1I864 | 127-224 | None |
| A0A7G2IIV9 | 7-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.