DPCstruct | MC37785
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 105 ± 13 aa |
| Standard deviation of domain lengths | 12.64 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 93.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 26.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A257SS66 | 17-144 | DEEQTVRARKLFESAESVLITDVVLVETVWTLTGKRYKATKEDIRTLVISLLEEPNTVFESQQVIWSALNDFVAAKPVKTANGAKTA… |
| A0A853QUE3 | 1-101 | LSPERPGYVSQVALIEVVWVLGRCYGVEREQMKDIVESMIGTRELVVESADTVRKALRVLASSKADFADCLIERSGHVAECEYTATF… |
| A0A2T2URN6 | 26-138 | None |
| A0A1V4GS19 | 4-104 | None |
| A0A1G1C892 | 2-104 | None |
| A0A378R1D5 | 1-113 | None |
| A0A378QW50 | 1-81 | None |
| A0A5C1MIS8 | 102-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.