DPCstruct | MC37781
Metacluster Properties and Pfam Annotations
| Number of structural domains | 75 |
|---|---|
| Mean domain length (aa) | 80 ± 14 aa |
| Standard deviation of domain lengths | 13.82 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 91.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 55.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0652 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A256ZTY5 | 38-105 | KFTPAKSLKRIAEDRVARKYPNMEVLNSYYLAEDGQNKYYEVILVDRAHPVIRADKKLQGIIKHRGRV |
| A0A4S4E1W0 | 606-691 | QLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRG |
| A0A7J0ED07 | 88-155 | None |
| A0A7J2HFL2 | 41-100 | None |
| A0A5D2LC79 | 115-183 | None |
| A0A821JN08 | 1-74 | None |
| A0A1V6SWC9 | 529-614 | None |
| A0A1J8QFI5 | 88-155 | None |
| A0A517LBK4 | 317-402 | None |
| A0A7R8H4A4 | 195-264 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.