DPCstruct | MC3778
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 117 ± 15 aa |
| Standard deviation of domain lengths | 15.39 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 19.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A839HHH7 | 1-92 | MSEGRQYFVLGIEADAYRILNDSGNPYLYEPALFDVIDNREANDWITEFGEEGERYAYPPLLNVSGFFEDYFDRKPEQISIFWSVVN… |
| A0A4Q3HFF4 | 1-116 | MRVVYTGTKLNRHFDSSRSYRVFTSSITQNALIYRLLADDLEDPALFDATEFTVVDTRLPKGWKLKKASGVVSDEGYQPLIEAGFWD… |
| A0A3D9HJV8 | 1-101 | None |
| A0A7Y5RM21 | 3-150 | None |
| A0A5A8AI18 | 1-119 | None |
| A0A518LH36 | 103-220 | None |
| A0A0F2N9Q7 | 2-114 | None |
| A0A5Q4ELY2 | 2-98 | None |
| A0A8B3TQ28 | 1-118 | None |
| A0A1G9PKQ0 | 8-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.