DPCstruct | MC37779
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 127 ± 33 aa |
| Standard deviation of domain lengths | 32.73 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 86.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 35.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5MPC4 | 1-100 | MKAGDLVRVRSREQIEATLNHWRQLKGCTFMPEMAQYCGTTQRVLRAMERFVDERELQVKRCRGIVLLEGVICQGTADFGRCDRSCH… |
| A0A7C5LMV4 | 15-128 | GRGVRPAAAEAGTSPLQAGDLVRVRSRAEIEATLNHWRQLKGCTFMPEMAPYCGSVQRVLKRMERFVDERDLEVKRSRGIVLLEGVL… |
| A0A7Y4YG33 | 136-253 | None |
| A0A6L9IU18 | 23-146 | None |
| A0A6G8FYW3 | 31-168 | None |
| A0A2W4SXX4 | 7-122 | None |
| A0A1V5H4P4 | 40-171 | None |
| A0A2V6ART4 | 6-116 | None |
| A0A1F9DAR6 | 1-72 | None |
| A0A0S8GZE7 | 6-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.