DPCstruct | MC37778
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 179 ± 23 aa |
| Standard deviation of domain lengths | 22.54 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 13.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5LK22 | 1-211 | MDGGATSARRPGLDWRLVAGINLLLGALLLFMDCTDYSWANNAADALFGPLVAIVAIVSMCGARWRATWRRWRIRIASLPSLIEGGM… |
| A0A1M5THH7 | 5-180 | KKIILRIYFIICALFVLDCLLYYFKEISLHGYYSDVVLSWLWLISSFVIIIVFWKKLLAKLFLTALLVTFAMSIIAMMLPFYTLLLS… |
| A0A2G1VST8 | 2-149 | None |
| A0A163ACF6 | 12-162 | None |
| A0A3S2XI59 | 1-177 | None |
| A0A4R3L7Y8 | 1-170 | None |
| A0A3E0VQV4 | 24-185 | None |
| A0A554A3K2 | 1-177 | None |
| A0A2P1WH11 | 48-221 | None |
| A0A7X6S9I7 | 39-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.