DPCstruct | MC37771
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 238 ± 15 aa |
| Standard deviation of domain lengths | 14.93 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 71.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 26.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J7Z0S0 | 17-245 | PARKLFDQDGGGRVHDPVVGRVQITRTVLGVLATFALYYAYGSDGDLEDQASESAAQLIVTPVLLLIAGPLIIALFIRYAPAERRRM… |
| A0A542WHX8 | 21-239 | PHHVSTAVFHPAWIPPSLDPSIDRLKRFRVIAGAVASIGVYTVLEGGFDVTELLENALTASAVLLFLTPLTVGVMLFVWRRTGTVSQ… |
| A0A401YT95 | 1-244 | None |
| A0A840NGM7 | 97-359 | None |
| S4MSR7 | 619-864 | None |
| D9UIK2 | 102-348 | None |
| A0A6H1RCP0 | 404-635 | None |
| A0A7Y3LSB7 | 2-211 | None |
| A0A7W7RZP6 | 15-256 | None |
| A0A2S9PZ94 | 13-262 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.