DPCstruct | MC37770
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 252 ± 60 aa |
| Standard deviation of domain lengths | 59.92 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 90.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 28.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02445 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H0PLJ6 | 14-259 | VLIADESAGCSLADKFTAENVREYRRLYPGSPVVTYINSYASVKAESDFCCTSANALRVVRYAAQEFGVRRVIFLPDTLMAENLENE… |
| A0A7C0UZE3 | 1-180 | DVCCTSANAVKIVESLDADTVIFGPDSNLAEYVSEKTGKNVIAIPPGGFCPTHLLFQPEEIQVLRTKYSDAVVAVHPECSREVRGLA… |
| A0A6I9RPR4 | 233-525 | None |
| A0A0E0J955 | 383-595 | None |
| A0A451BS17 | 58-294 | None |
| A0A378VTA5 | 1-194 | None |
| K4L413 | 36-347 | None |
| A0A8B0KQR2 | 49-402 | None |
| A0A7V0M2A9 | 25-300 | None |
| A0A4V1URG6 | 6-244 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.