DPCstruct | MC37767
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 196 ± 24 aa |
| Standard deviation of domain lengths | 24.25 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 89.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 30.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L3LD89 | 11-219 | AIGPRHKVYQTGDWNIYTPRHTPDANLTGHLTFALRYEGLDLATLKALFRAAGPDAIVDIVRASPTGSYARRLWFLYEWLLATRLDL… |
| C6HZH4 | 1-207 | MTIPIGYQWLIRHLDLEVPSPIQISVIGKSATSESYSKDKIKVFRKEYQVPDDPLSHLSFALKHEPLDLSIIERTLKKINRKTIEER… |
| A0A5E7PYV2 | 1-184 | None |
| A0A3A0C4X9 | 21-202 | None |
| A0A0D6Q1P1 | 31-215 | None |
| A0A4Q3RQW5 | 2-186 | None |
| A0A1K1QE44 | 1-164 | None |
| A0A1I5XEG3 | 25-239 | None |
| A0A420S0H4 | 321-571 | None |
| A0A1I5HP30 | 25-259 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.