DPCstruct | MC37764
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 207 ± 51 aa |
| Standard deviation of domain lengths | 51.49 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 77.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 28.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A4S4C0 | 30-279 | ELMYVDALWNYYNGGKFTLSDEDYDRLREELNWQGSGFPTLRRYEIEFVQAAISYSRGESVVDDDKYEELKRRVKAEGKRTDVTALL… |
| K0R0P7 | 483-673 | RLTLEEKERIFMDALQSYYVSGRQLLNDAEFDMLKEDLAWQGSSLVNMNRQETKYLAAVQAYLKGEPIVSDEEFDALKTELMESKSA… |
| A0A0R0HU24 | 1-183 | None |
| A0A7S0CSG1 | 102-386 | None |
| A0A5N5I4H3 | 50-195 | None |
| A0A835HHX9 | 43-234 | None |
| A0A7S2AN75 | 12-187 | None |
| C1E4H5 | 45-326 | None |
| A0A7J7ISB7 | 39-258 | None |
| A0A453MKS3 | 24-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.