DPCstruct | MC37763
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 244 ± 16 aa |
| Standard deviation of domain lengths | 16.16 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 29.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12397 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P4XI43 | 2-236 | ASALASQLQQLREAGAGSKRRTDTFLYDQREAARLDDETVYNLAWNGLLELKQLDARFEELDADAGVAKLFSRQRIHFHRAQSSKQD… |
| A4S122 | 2-221 | APSTALADALRGLQERAGAHERRIGKNAKASLLYDVKDAADVDRETAHAIGARGFEELCRRDGRFELHAKTLFARSVAEGKHRELET… |
| S9XAT3 | 29-264 | None |
| G0UTH8 | 3-252 | None |
| A0A1I8HRH6 | 509-758 | None |
| U4UK79 | 2-243 | None |
| A0A7J7QBC8 | 3-237 | None |
| D7L282 | 2-259 | None |
| A0A6J0N6F9 | 4-249 | None |
| A0A0D2N348 | 1-231 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.