DPCstruct | MC37762
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 284 ± 42 aa |
| Standard deviation of domain lengths | 41.82 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W4P3A3 | 9-334 | FHLFSLPASHIPLPEKFTYPFHYTPHPLCVLAAEEVKRYIGSRKEWEAELSLGKMFGVLAVQDEQGTVGYLAAFSGNLAGRNDHPYF… |
| A4RWL7 | 1-278 | MIGALVGRRKTTGERVTLKAFSGQLFGEWRVEGWAPPVGELTHDTAYYKSEHGKIKALSERIAKAEMEERMTRAEVREATAARDDEA… |
| A0A1Y4AKW8 | 1-343 | None |
| A0A3C0CFP3 | 2-325 | None |
| A0A511QRZ9 | 1-268 | None |
| A0A090WHN3 | 1-217 | None |
| A0A090QMM9 | 2-237 | None |
| D8U6U0 | 32-307 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.