DPCstruct | MC37761
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 354 ± 80 aa |
| Standard deviation of domain lengths | 79.53 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 77.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 21.28 |
| Pfam Score | 76.05 |
| Assigned Pfam label(s) | PF03234- PF08564- PF08565 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A4RT65 | 1-366 | MSTKPFDYSKWDAIELSDDEDSHPGAQFIEAQTLRRIKREAHEHKERERIARVDALKTKKKALKREIKSEEETLVRTVETLTPEADG… |
| A0A444UYF3 | 1-246 | MVDYSVWDHIEVSDDEDDTHPNIDTASLFRWRHQARMDRMEQFQKEREDLEKAQGECKRKLSEVQRKIKELEVSGTDDAKSELQKLQ… |
| A0A7R9YE37 | 36-452 | None |
| A0A5C2SIN5 | 20-417 | None |
| A0A1Y1XLI8 | 2-347 | None |
| A0A058Z5I1 | 3-370 | None |
| A0A167FI12 | 2-397 | None |
| A0A673HYF1 | 10-335 | None |
| A9VAT3 | 419-719 | None |
| A0A1W2TCN6 | 2-452 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.