DPCstruct | MC37760
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 191 ± 31 aa |
| Standard deviation of domain lengths | 30.85 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 42.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0108- PF03999 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A4RQP9 | 20-187 | EEAKKRHKEEREKLQAERDARVQPGPEDPEALVRYFFETEINEMEYEIVRCRPLLTDDFFNSLKASIEKEEGLEKEKREALYTVTSG… |
| A0A287GYT0 | 12-166 | RVIPETDAGLVEFFLDTDAREIEIEIGRLRPRLNKAFFDHIQREIAQIKFAVTRTAANEDRLIELEAMQKVIGEGVEAYDKLQNDLV… |
| A0A6A1VVV1 | 15-263 | None |
| A0A3L6PBR7 | 40-245 | None |
| C1DZ67 | 2-222 | None |
| A0A0D2NL00 | 30-237 | None |
| A0A1Y1HKP8 | 52-257 | None |
| A0A6A6LEV4 | 20-190 | None |
| A0A835IG30 | 1-144 | None |
| A0A835IBI0 | 2-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.