DPCstruct | MC3776
Metacluster Properties and Pfam Annotations
| Number of structural domains | 119 |
|---|---|
| Mean domain length (aa) | 69 ± 7 aa |
| Standard deviation of domain lengths | 7.01 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 52.87 |
| Pfam Score | 97.50 |
| Assigned Pfam label(s) | CL0067- PF04998 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y2X4A2 | 120-194 | QGITRASLQTKSFISAASFQETTKVLNEAAVSGKVDTLEGLKENVIVGHKIPAGTGMRDYEDIIVGSKEEYDEIM |
| A0A7V4A1D0 | 135-220 | KPLLMGVTKSALSTKSWLSAASFQNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGNDFVRFTQVVDRKTLKAIEEARKEAV |
| A0A3B0P056 | 128-192 | None |
| A0A6B1F5J4 | 447-523 | None |
| A0A7Y7CRY0 | 355-424 | None |
| A0A830CAL8 | 9-70 | None |
| A0A7V3AU47 | 1-66 | None |
| A0A7R9FUS0 | 100-167 | None |
| A0A1V5HR83 | 61-127 | None |
| A0A0G1K9N5 | 641-712 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.