DPCstruct | MC37756
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 196 ± 20 aa |
| Standard deviation of domain lengths | 20.36 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 67.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.98 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 41.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R8BU21 | 1-226 | MPPVQKTFDLIPNILGSGLGRPGLAHDAAPHGPPAKPPMTSKQAKKLYKQANKAPKLSKAEQRRIELMEQDRIRKELEKEKAQARTR… |
| A0A1W2TKV9 | 1-154 | MAPDPPSRPAARPMTTKQVKKAYQKANKGPKLSKAEQRRQELFEQDRIRKEFEKERNQARARAARDKKREKEQRERAERKKKGMPLV… |
| A0A3S4AUC9 | 1-179 | None |
| A0A0P7ATP2 | 1-166 | None |
| A0A1B7YM18 | 66-272 | None |
| A0A0G2FF65 | 1-227 | None |
| A0A5N5J4C3 | 1-189 | None |
| A0A1Q8RMA4 | 1-199 | None |
| G2RAH9 | 1-206 | None |
| M7TGK0 | 1-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.