DPCstruct | MC37752
Metacluster Properties and Pfam Annotations
| Number of structural domains | 81 |
|---|---|
| Mean domain length (aa) | 262 ± 59 aa |
| Standard deviation of domain lengths | 59.18 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 76.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 19.18 |
| Pfam Score | 99.02 |
| Assigned Pfam label(s) | PF11905- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R8BLC7 | 53-304 | AGAGQVMGSGFNQGSGMPRLDFATDALTPTSDNLAGYSAPIKNCPPTCPLDSLLLDFLQERRQRAAEGLSPQDIIGPKYPSVSSLLN… |
| A0A2V1BY79 | 13-210 | CPLDQILLDFLASRRVLASQGTPISTLIGPPNPSISGLINPKLKNNAHATSRVMVDVVSTFKDTNLREQLGFLYIMYATLRWQIGPS… |
| A0A0G4KJ78 | 15-221 | None |
| A0A1A6A9K9 | 330-568 | None |
| A0A6A5ZM75 | 5-184 | None |
| A0A366R8P6 | 105-400 | None |
| A0A395HA02 | 27-267 | None |
| A0A395H8A4 | 159-424 | None |
| A0A0D2H1W1 | 98-302 | None |
| A0A178CQA0 | 241-641 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.