DPCstruct | MC3775
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 140 ± 19 aa |
| Standard deviation of domain lengths | 18.52 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 30.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W8ENG3 | 1-103 | MRSNGRSILASTLPPNDLNLHPGERLTMVCPDCRTWRVIRRGMIWPHRADDGVTRCPGSGTRLVVDLTSVEWRSAMVVAVRQAATRR… |
| A0A3M2MDM9 | 1-153 | MKHNGRPPISVSALPLNHVNLRRPDGERPDGERTMIVCPDCGTWVSLKRHLVLPHRISRYTDKQIRNFALGRRPAPAARRQERCPGS… |
| A0A7J0D6Q2 | 27-173 | None |
| A0A7X0FUS1 | 1-117 | None |
| A0A286E822 | 21-177 | None |
| A0A2A2D5U0 | 1-151 | None |
| H2KA64 | 1-142 | None |
| A0A117QWT6 | 14-160 | None |
| A0A401YYP9 | 20-185 | None |
| A0A345XSS6 | 7-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.