DPCstruct | MC37747
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 199 ± 26 aa |
| Standard deviation of domain lengths | 26.13 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 22.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18551 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A8UTU9 | 5-207 | ELFLLSYLFTHSTILIHGFLTPYSAKGLSFPLLKVLFGQDSNFDEWNFLQNLVSRDLLLQEKLIDEIQTCPSCTSGLLNYKNSYPNC… |
| A0A3P3W7M7 | 126-317 | YTFKILNYYYTRKKNIVPNINRKSLTGYSYTRIEAFFENKNDAYTKSRMLLREAFLGGSLARNYVDTSHLCKNCHSGFLNFREVCPK… |
| A0A7J2HTL9 | 70-275 | None |
| E6N7Y0 | 16-210 | None |
| A0A497P0W3 | 29-220 | None |
| A0A662V233 | 17-218 | None |
| A0A662GPR8 | 16-178 | None |
| A0A1I0RLZ0 | 145-333 | None |
| A0A497F5V7 | 19-218 | None |
| A0A5C5YEF3 | 262-419 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.