DPCstruct | MC37746
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 61 ± 5 aa |
| Standard deviation of domain lengths | 5.48 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 34.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A8UTQ8 | 2-57 | DYLNLWEQLAGVPINDEDEIEEDFLHFEKGTNKFELWTWFDGKLPKGIAHELFKMS |
| A0A6P3B1I4 | 171-225 | DLYQLWDKLGDVPVTDDGQHLDESFLHFGRGAEKESVWRWFEAANPRFVVSEVMQ |
| A0A3S5AQN2 | 48-106 | None |
| A0A1C5M9Y2 | 88-148 | None |
| A0A164LB61 | 168-230 | None |
| A0A108E635 | 88-151 | None |
| A0A2H0G8L0 | 46-112 | None |
| A0A2I8Q107 | 5-66 | None |
| A0A396C6U9 | 107-160 | None |
| A0A350TI12 | 101-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.