DPCstruct | MC37735
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 115 ± 16 aa |
| Standard deviation of domain lengths | 16.34 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 37.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0382 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1JY51 | 243-360 | LDLLPAKSRELYENNYLRFMNWRKSQNVDTFSENILIKYLTELSATVKPSTLWSHYSMLKATLHIKHGVNIKSYSKLTLFLKNKSCG… |
| A0A2P8Y2T8 | 14-125 | SSTPPDIIEEASDVVNNLLPVKSEKVYFEEMSKTMKFPTLWTNYSVLKTTLNVKHGIDISQYTKLYSLLKQKSVGYNGKKAKIFSTD… |
| A0A834XZB2 | 38-152 | None |
| A0A1Y1NMZ1 | 44-175 | None |
| A0A5N4A3S6 | 12-129 | None |
| A0A5N4ACX5 | 4-94 | None |
| A0A482VB57 | 1-95 | None |
| A0A482VC71 | 2-106 | None |
| A0A482VIM7 | 10-126 | None |
| A0A482VP82 | 1-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.