DPCstruct | MC37733
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 117 ± 11 aa |
| Standard deviation of domain lengths | 10.59 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 45.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P8ZEM1 | 16-150 | KAILGVSKTTQSRLAYLLTRETFLIDDLRTSILLPSTSASQKMLALLNGKREEIHPDFYSTGAMVDRAWTKENFEMRHVITRLAVHG… |
| A0A2P8XZY6 | 16-128 | TYLLMKETFVIEDIRQQLLLPNTWAYETTLQGLQEKRNNICSEFYTTEAMCSREWTQPNYEMRHILTRYSVHGFHHKVCSMIKPRMQ… |
| A0A2P8YXU3 | 3-121 | None |
| A0A2P8YUA1 | 72-190 | None |
| A0A2P8YMI7 | 2-111 | None |
| A0A2P8Y996 | 54-170 | None |
| A0A2P8ZEL0 | 208-326 | None |
| A0A2P8XGY6 | 231-341 | None |
| A0A2P8Y1U2 | 411-528 | None |
| A0A2P8XZM8 | 676-807 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.