DPCstruct | MC37731
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 197 ± 43 aa |
| Standard deviation of domain lengths | 43.16 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 77.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 37.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15433 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P8XWS6 | 25-196 | DIMSKLLAEESAKHGKGSKKSGNWRQSVRVDIFGGRPLNIFKDVPSEAKVADLHELSTWKKLVSRELRLAATQPPANIYEEMILWTE… |
| A0A0P4VY46 | 5-151 | HVDLFGGQPLGIFKKREEDTHGPAAPISVLPTWERLYLHELEQSMQHPPSNAFVEMIQWTKQGKLWTFPIDNEAAGLVEEMKVGFHE… |
| A0A654GMT8 | 298-494 | None |
| A0A7M7IHA1 | 14-170 | None |
| A0A6I9HGY7 | 71-285 | None |
| A0A4U5M958 | 22-142 | None |
| A0A154PAR5 | 317-533 | None |
| A0A0N1ID54 | 409-658 | None |
| A0A1X7SEP8 | 1-127 | None |
| A0A3Q3AI78 | 103-351 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.